DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13312 and CG10154

DIOPT Version :9

Sequence 1:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster


Alignment Length:239 Identity:48/239 - (20%)
Similarity:81/239 - (33%) Gaps:86/239 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DCQECNKCDETQTFACTGTQSFALCLGTDTVQDSVGTCASGYVCNINDTQICGLPADGVMPTCSY 154
            :|.:..:| |..|....|:     ||  |..:|:...|        :..:.|.|..|.|:..|:|
  Fly    72 NCSKYIEC-ENNTIKEVGS-----CL--DLAKDNPDIC--------DPNKSCELGYDPVLQVCTY 120

  Fly   155 SDDSTTTTVSSTTSSTTAAPPSTSS--ASTYCAAVQSQGKYAVGYNAYTTCRQYIYCTLVDGSWI 217
            .::             ....|:..|  .|::|            |:  .||.:|:.|      :.
  Fly   121 MEE-------------VQCLPTCESFRLSSFC------------YD--NTCTKYVLC------YY 152

  Fly   218 GQTY--TCPGSMYFDSASEMC-----VSTMPSTCSTTATTSSTTTAAPTTSNPEAYCQAMQSAGY 275
            |:..  .|...:.:::|::.|     |..:.:.||.|                      .|....
  Fly   153 GKPVLRQCHDGLQYNNATDRCDFPEYVDCVANDCSAT----------------------FQPEDI 195

  Fly   276 YPVGTDASTTCHQYIDCFLNGGTWGGNMYTCPGSLYYNSASRTC 319
            ..:|:.||  |.:|..| .||..|   ...|...|.||.:.:.|
  Fly   196 IYLGSKAS--CSKYYVC-SNGHPW---EQQCAPGLAYNPSCKCC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13312NP_648260.1 None
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 12/69 (17%)
CBM_14 197..239 CDD:279884 14/43 (33%)
ChtBD2 263..311 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.