DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13312 and CG5883

DIOPT Version :9

Sequence 1:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:218 Identity:57/218 - (26%)
Similarity:77/218 - (35%) Gaps:58/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 GTDTVQDSVGTCASGYVC-NINDTQICGLPADGVMPTCSYSDDSTTTTVSSTTSSTTAAPPSTSS 179
            ||..::.  |:|:...:| |...|.  |:...|..|..|.|..|                 ..:|
  Fly    41 GTQLLKP--GSCSESIICQNFESTP--GITCSGSKPYYSKSKGS-----------------CQAS 84

  Fly   180 ASTYCAAVQSQGKYAVGYNAYT-TCRQYIYCTLVDGSWIGQTYTCPGSMYFDSASEMCVSTMPST 243
            |.|||...:.......||...| .|..:.||   |...:....||...||||..|:.||.:..:.
  Fly    85 ADTYCDTSKICKGSGTGYIGDTINCANWYYC---DADALLGKGTCNLGMYFDQVSKSCVYSEDTV 146

  Fly   244 CSTTATTSSTTTAAPTTSNPEAYCQAMQSAGYYPVGT----DASTTCHQYIDCFLNGGTWGGNMY 304
            |:.                      ..:.....||||    ||:  ||:|..|  :..:...|  
  Fly   147 CAA----------------------KYEICDVAPVGTPFRDDAN--CHKYYTC--SSKSLVEN-- 183

  Fly   305 TCPGSLYYNSASRTCVSTLPSTC 327
            ||...||||.|:.|||......|
  Fly   184 TCENGLYYNVATGTCVRKKDVIC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13312NP_648260.1 None
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 16/53 (30%)
CBM_14 154..204 CDD:279884 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.