DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13312 and CG33986

DIOPT Version :9

Sequence 1:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:272 Identity:61/272 - (22%)
Similarity:91/272 - (33%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLGCLVSSTHGTCNVCNTVNNLTCYSSTQMQSCQVDVLS--TATPTDCPSGYVCVSGSSGVL--C 78
            ::.||:::...|.......|::|...|.. :.|...::.  .....||...|:||.....||  |
  Fly    10 IVNCLLATAQLTWRPSKPTNSVTIRQSGS-RICANHLVGEFVEHAEDCHMFYLCVENGDAVLASC 73

  Fly    79 QP------EDSASDSQADCQECNKCDETQTFACTG-----------TQSFALCLGTDTVQDS--- 123
            .|      |....||..:.:..|:.|..:|....|           |.:...|......|.|   
  Fly    74 PPTMLFNSESRLCDSATNVKCRNETDPIETPPFDGGNGDGDPNNMVTDAATYCSTLVEQQQSSDR 138

  Fly   124 ---VG---TCASGYVCNIND---------------TQICGLPADGVMPTCSYSDDSTTTTVSSTT 167
               ||   :|...|:|....               |..|.:| :....|....:|..|...|...
  Fly   139 IVYVGSSSSCRKYYICYYGQAILQECSSQLHWNAMTGKCDIP-ERAQCTVGGQEDMPTNGNSGFP 202

  Fly   168 SSTTAAPPSTSSASTYCAAVQSQGKYAVGYNAYTTCRQYIYCTLVDGSWIGQTYTCPGSMYFDSA 232
            |..||    .||...:|.|   .|::.  |.....|..:|||  |.|.  .....||...:||.|
  Fly   203 SGGTA----ISSDLIHCPA---YGQHL--YPHMQRCEFFIYC--VKGH--ASLQQCPFYYFFDIA 254

  Fly   233 SEMCVSTMPSTC 244
            ::.|..:..:.|
  Fly   255 TKSCQWSRTAQC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13312NP_648260.1 None
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 13/50 (26%)
CBM_14 141..185 CDD:279884 8/44 (18%)
ChtBD2 213..261 CDD:214696 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.