DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13312 and obst-B

DIOPT Version :9

Sequence 1:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:166 Identity:35/166 - (21%)
Similarity:58/166 - (34%) Gaps:45/166 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PEDSASDSQADCQECNKCDETQTFACTGTQ--SFALCLGTDTVQDSVGT---CASGYVCNIND-- 137
            |:...:.::.:.:...:|.|...|.....|  .:..||      |.|.|   ||.|.|  .||  
  Fly    69 PKSKQTAAEKEYEPTEECPEPNGFYPDSKQCDKYYACL------DGVPTERLCADGMV--FNDYS 125

  Fly   138 --TQICGLPADGVMPTCSYSDDSTTTTVSSTTSSTTAAPPSTSSASTYCAAVQSQGKYAVGYNAY 200
              .:.|.||         |:.|....:...|...:...|             :..|.:  |:...
  Fly   126 PIEEKCDLP---------YNIDCMKRSKLQTPQPSLHCP-------------RKNGYF--GHEKP 166

  Fly   201 TTCRQYIYCTLVDGSWIGQTYTCPGSMYFDSASEMC 236
            ..|.::.:|  |||.:  ...|||..:.|:..:.:|
  Fly   167 GICDKFYFC--VDGQF--NMITCPAGLVFNPKTGIC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13312NP_648260.1 None
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 17/66 (26%)
CBM_14 156..204 CDD:279884 12/49 (24%)
CBM_14 233..278 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.