DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13312 and obst-B

DIOPT Version :10

Sequence 1:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:166 Identity:35/166 - (21%)
Similarity:58/166 - (34%) Gaps:45/166 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PEDSASDSQADCQECNKCDETQTFACTGTQ--SFALCLGTDTVQDSVGT---CASGYVCNIND-- 137
            |:...:.::.:.:...:|.|...|.....|  .:..||      |.|.|   ||.|.|  .||  
  Fly    69 PKSKQTAAEKEYEPTEECPEPNGFYPDSKQCDKYYACL------DGVPTERLCADGMV--FNDYS 125

  Fly   138 --TQICGLPADGVMPTCSYSDDSTTTTVSSTTSSTTAAPPSTSSASTYCAAVQSQGKYAVGYNAY 200
              .:.|.||         |:.|....:...|...:...|             :..|.:  |:...
  Fly   126 PIEEKCDLP---------YNIDCMKRSKLQTPQPSLHCP-------------RKNGYF--GHEKP 166

  Fly   201 TTCRQYIYCTLVDGSWIGQTYTCPGSMYFDSASEMC 236
            ..|.::.:|  |||.:  ...|||..:.|:..:.:|
  Fly   167 GICDKFYFC--VDGQF--NMITCPAGLVFNPKTGIC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13312NP_648260.1 None
obst-BNP_609339.1 CBM_14 89..139 CDD:426342 17/66 (26%)
CBM_14 156..204 CDD:426342 12/49 (24%)
CBM_14 233..278 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.