DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13312 and obst-A

DIOPT Version :9

Sequence 1:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster


Alignment Length:169 Identity:39/169 - (23%)
Similarity:60/169 - (35%) Gaps:48/169 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NVCNTVNNLTCYSSTQMQS------C--QVDVLSTATPTDCPSGYVCVSGS-------------- 73
            |.|:...|:.|...|::|.      |  :....:...|..|...|.|:.|.              
  Fly    68 NKCDQPFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDE 132

  Fly    74 -SGVL----------CQPEDSASDSQADC-QECNKCDETQTFAC-------TGTQSFALCLGTDT 119
             ||..          |.||...|::...| ::..|.|:......       |..|.|.:||..:.
  Fly   133 YSGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGED 197

  Fly   120 VQDSVGTCASGYVCNINDTQICGLPADGVMPTCS--YSD 156
            .:| :| |..|.|.| :.|::|..|.:  :|.|.  |.|
  Fly   198 PRD-LG-CQLGEVYN-DATEMCDAPEN--VPGCEDWYKD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13312NP_648260.1 None
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 3/8 (38%)
CBM_14 95..143 CDD:366726 7/47 (15%)
CBM_14 180..225 CDD:366726 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.