DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13312 and CG32024

DIOPT Version :9

Sequence 1:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_729417.2 Gene:CG32024 / 317828 FlyBaseID:FBgn0052024 Length:209 Species:Drosophila melanogaster


Alignment Length:235 Identity:69/235 - (29%)
Similarity:110/235 - (46%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LFLLGCLVSSTHGTCNVCNTVNNLTCYSSTQMQSCQVDVLSTATPTDCPSGYVCVSGSSGVLCQP 80
            :|||..||..:...||:|::.:|:.|.|..|.|:|..:.:.|.|...||:...|    :|:   |
  Fly     9 VFLLATLVKFSQAECNICSSESNVACVSKNQYQNCSANAIPTGTVYTCPNNTFC----TGL---P 66

  Fly    81 ED-SASDSQADCQECNKCDETQTFACTGTQSFALCLGTDTVQDSVGTCASGYVCNINDTQICGLP 144
            |. :::::.|.|.:|.|||....||||...:||||...:.:..:...|::|.||.......|...
  Fly    67 EKCTSNEAFASCNDCRKCDGIIPFACTSPTTFALCNAVNEIASNEYPCSTGEVCLYQIGNPCVAS 131

  Fly   145 ADGVMPTCS-YS--DDSTTTTVSSTTSSTTAAPPSTSSASTYCAAVQSQGKYAVGYNAYTTCRQY 206
            .:|...:|| |:  ||                         .|....|.|::.  |....:|.:|
  Fly   132 PNGTSASCSQYALIDD-------------------------LCIQKSSTGRFP--YPNDLSCLKY 169

  Fly   207 IYCTLVDGSWIGQTYTCPGSM-YFDSASEMCVSTMPSTCS 245
            |||.....:|.|.::.||.|. ||.:::..||:|.|:||:
  Fly   170 IYCFRKSSTWSGNSWQCPSSKPYFSASTSTCVATKPATCA 209



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.