DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13312 and cpg-1

DIOPT Version :9

Sequence 1:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001021159.1 Gene:cpg-1 / 175586 WormBaseID:WBGene00000465 Length:584 Species:Caenorhabditis elegans


Alignment Length:331 Identity:79/331 - (23%)
Similarity:115/331 - (34%) Gaps:99/331 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLGCLVSSTHGTCNVCNTVNNLTCYSSTQMQSCQVDVLSTATPTDCPSGYVCVSGSSGVL----C 78
            ||..||:|.:....|.....||...::|      :|.....:..|  :|:  |||:..|.    |
 Worm     7 LLAFLVASAYAQYGVAGMYENLPLETTT------LDGSGDGSGAD--NGF--VSGADAVAIDTDC 61

  Fly    79 QPEDSASDSQADCQECNKCDETQTFACTGTQSFALCLGTDTVQD-SVGTCASGYVCNINDTQICG 142
            ..::....:...|       ..|...|:|..|..:....|.:.| .:..|...|    |..|..|
 Worm    62 STKEDGLYAIGGC-------SPQFLTCSGGISRIMDCPADLIYDPRIVACEYSY----NVPQCGG 115

  Fly   143 LPAD-------------GVMP----------------------TCSYS--DDSTTTTVS------ 164
            :|.|             .|.|                      |.:|:  ||.:|||.:      
 Worm   116 VPQDVTSTQEAYPSEETTVNPYAPVEEATTTPAEDVTVPEETTTEAYAPVDDYSTTTPAEDVPVP 180

  Fly   165 -STTSS--------TTAAP----PSTSSASTYCAAVQSQGKYAVG--YNAYTTCRQYIYCTLVDG 214
             .||:|        ||.||    |.|.||.|.....::.|.|:.|  .:.||.|.        :|
 Worm   181 VETTASPYAPIVPYTTGAPAADEPVTRSAVTKSCVGKADGFYSFGECSDHYTACS--------NG 237

  Fly   215 SWIGQTYTCPGSMYFDSASEMCVSTMPSTCSTTATTSSTTTAAPTTSNPEAYCQAMQSAGYYPVG 279
            ..|  ...||..:.||.|..:|...|.....|..:.:...:|..||  ||:..:...|.||   |
 Worm   238 YLI--PMQCPARLAFDEARVICDYVMNVPECTNGSGNDEGSADETT--PESSGEMPYSNGY---G 295

  Fly   280 TDASTT 285
            .:.:||
 Worm   296 YEETTT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13312NP_648260.1 None
cpg-1NP_001021159.1 CBM_14 61..113 CDD:279884 11/62 (18%)
CBM_14 214..266 CDD:279884 15/61 (25%)
CBM_14 <537..576 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.