DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13311 and CG34426

DIOPT Version :9

Sequence 1:NP_648258.1 Gene:CG13311 / 39008 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001097552.1 Gene:CG34426 / 5740622 FlyBaseID:FBgn0085455 Length:296 Species:Drosophila melanogaster


Alignment Length:146 Identity:47/146 - (32%)
Similarity:78/146 - (53%) Gaps:11/146 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIVVVSSMAV--LVQGVCNSCQANNVKCLNETHYSFCSDNVAPNQV-LQCPDNK-VCTDLAIICM 72
            |||::|::..  :|...|..| .:...|:.|:.:..|.|.|....: ..||::| :||...||||
  Fly     2 LIVLLSALVAPSIVSAACGQC-VDAHSCIGESEFQLCYDGVRDQTINYTCPESKPICTTYGIICM 65

  Fly    73 -DSSVVDSSCSGTADGSCPTCDGNSMFVCTSRTTFQMCDGTNLTGQVTKCKDNKICSIK---SGK 133
             :.:.::..|...:  :|..|..::.|.|||||||.:|:|..::.....|.::.:||:|   ||.
  Fly    66 PNGTSIERGCGDVS--NCGVCSESTTFACTSRTTFAVCNGDVVSANSFDCAEDFVCSVKNAASGS 128

  Fly   134 YCVDLCEVGDSVECDR 149
            .|:..|:..||..|||
  Fly   129 PCISRCDSSDSDICDR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13311NP_648258.1 None
CG34426NP_001097552.1 DUF1450 <66..116 CDD:299744 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.