Sequence 1: | NP_648258.1 | Gene: | CG13311 / 39008 | FlyBaseID: | FBgn0035929 | Length: | 153 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648260.1 | Gene: | CG13312 / 39010 | FlyBaseID: | FBgn0035931 | Length: | 342 | Species: | Drosophila melanogaster |
Alignment Length: | 130 | Identity: | 35/130 - (26%) |
---|---|---|---|
Similarity: | 53/130 - (40%) | Gaps: | 9/130 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 LIVVVSSMAVLVQGVCNSCQ-ANNVKCLNETHYSFCS-DNVAPNQVLQCPDNKVCT--DLAIICM 72
Fly 73 DSSVVDSSCSGTAD-GSCPTCDGNSMFVCTSRTTFQMCDGTN-LTGQVTKCKDNKICSIKSGKYC 135
Fly 136 135 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45471624 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2F9QR | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005298 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.830 |