powered by:
Protein Alignment Acbp5 and ACBP6
DIOPT Version :9
Sequence 1: | NP_648255.1 |
Gene: | Acbp5 / 39005 |
FlyBaseID: | FBgn0035926 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_174462.1 |
Gene: | ACBP6 / 840069 |
AraportID: | AT1G31812 |
Length: | 92 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 37/71 - (52%) |
Gaps: | 2/71 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 DFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVDD 65
:|....||....::.|..|..|..||||||.:.|.::..:|. ..:..||:|||.:.:|.|.::
plant 6 EFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEE 70
Fly 66 AKAAYV 71
|...|:
plant 71 AMNDYI 76
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp5 | NP_648255.1 |
ACBP |
2..76 |
CDD:412233 |
23/71 (32%) |
ACBP6 | NP_174462.1 |
ACBP |
3..87 |
CDD:238248 |
23/71 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG63566 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1588000at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23310 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
6 | 5.890 |
|
Return to query results.
Submit another query.