DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and ACBP6

DIOPT Version :9

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_174462.1 Gene:ACBP6 / 840069 AraportID:AT1G31812 Length:92 Species:Arabidopsis thaliana


Alignment Length:71 Identity:23/71 - (32%)
Similarity:37/71 - (52%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVDD 65
            :|....||....::.|..|..|..||||||.:.|.::..:|.  ..:..||:|||.:.:|.|.::
plant     6 EFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEE 70

  Fly    66 AKAAYV 71
            |...|:
plant    71 AMNDYI 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:412233 23/71 (32%)
ACBP6NP_174462.1 ACBP 3..87 CDD:238248 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.