DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and ACBP1

DIOPT Version :10

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_200159.1 Gene:ACBP1 / 835428 AraportID:AT5G53470 Length:338 Species:Arabidopsis thaliana


Alignment Length:69 Identity:20/69 - (28%)
Similarity:33/69 - (47%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SKKPPTEVYLEFYGLYKQFQEGDINIEKPADAE--GAAKYDAWLSRKGLSVDDAKAAYVALYEKY 77
            |:|...|:.|:.|||||...||.....:|:..:  ..||:.||.....:..::|...|:.|..:.
plant   114 SQKVSNELQLQLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIDLVTQL 178

  Fly    78 NPIY 81
            .|.:
plant   179 YPAW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:469667 19/62 (31%)
ACBP1NP_200159.1 ACBP 113..175 CDD:459982 18/60 (30%)
ANKYR <215..>323 CDD:440430
ANK repeat 221..248 CDD:293786
ANK repeat 250..281 CDD:293786
ANK repeat 283..314 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.