DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and ACBP5

DIOPT Version :10

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001331946.1 Gene:ACBP5 / 832825 AraportID:AT5G27630 Length:668 Species:Arabidopsis thaliana


Alignment Length:71 Identity:20/71 - (28%)
Similarity:32/71 - (45%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPADAEGAAKYDAWLSRKGLSV---DDAKAAYVAL 73
            |..|.|...:..|..|.|::|...|..:|.||: |....:...|.|.:||..   .:|...:|.:
plant    34 KQLSSKFSNDTSLLLYTLHQQATLGPCSIPKPS-AWNPVEQSKWKSWQGLGTMPSIEAMRLFVKI 97

  Fly    74 YEKYNP 79
            .|:.:|
plant    98 LEEADP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:469667 18/66 (27%)
ACBP5NP_001331946.1 ACBP 15..98 CDD:459982 18/64 (28%)
NanM 182..426 CDD:442289
KELCH repeat 185..271 CDD:276965
KELCH repeat 296..343 CDD:276965
KELCH repeat 347..395 CDD:276965
KELCH repeat 398..440 CDD:276965
COG4372 549..>651 CDD:443500
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.