DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and ACBP2

DIOPT Version :10

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_194507.1 Gene:ACBP2 / 828891 AraportID:AT4G27780 Length:354 Species:Arabidopsis thaliana


Alignment Length:69 Identity:19/69 - (27%)
Similarity:34/69 - (49%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SKKPPTEVYLEFYGLYKQFQEGDINIEKPADAE--GAAKYDAWLSRKGLSVDDAKAAYVALYEKY 77
            |:|.|::|..:.|||||...||.....:|:..:  ..||:.||.....:..::|...|:.:..:.
plant   124 SQKVPSDVQQQLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIEIVTQL 188

  Fly    78 NPIY 81
            .|.:
plant   189 YPTW 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:469667 18/62 (29%)
ACBP2NP_194507.1 ACBP 105..185 CDD:459982 18/60 (30%)
ANKYR <230..>338 CDD:440430
ANK repeat 236..263 CDD:293786
ANK repeat 265..296 CDD:293786
ANK repeat 298..329 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.