DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and ACBP3

DIOPT Version :10

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001119041.1 Gene:ACBP3 / 828524 AraportID:AT4G24230 Length:366 Species:Arabidopsis thaliana


Alignment Length:80 Identity:24/80 - (30%)
Similarity:37/80 - (46%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPADA--EGAAKYDAWLSRKGLSVD 64
            |..|.:.|..||  ::...|..:|.:||:|...||.....:|...  ...||::||.....:|.:
plant   237 AAVNLLEESGKA--EEIGAEAKMELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKLGNMSQE 299

  Fly    65 DAKAAYVALYEKYNP 79
            :|...|:||..|..|
plant   300 EAMEQYLALVSKEIP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:469667 22/75 (29%)
ACBP3NP_001119041.1 ACBP 232..309 CDD:459982 21/73 (29%)

Return to query results.
Submit another query.