DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and ACBP4

DIOPT Version :10

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_974227.1 Gene:ACBP4 / 819707 AraportID:AT3G05420 Length:669 Species:Arabidopsis thaliana


Alignment Length:66 Identity:20/66 - (30%)
Similarity:30/66 - (45%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KPPTEVYLEFYGLYKQFQEGDINIEKPADAEGAAKYDAWLSRKGLSV---DDAKAAYVALYEKYN 78
            |.|.:..|..|.||:|...|..|..||: |....:...|.|.:||..   .:|...:|.:.|:.:
plant    38 KFPDDTALLLYALYQQATVGPCNTPKPS-AWRPVEQSKWKSWQGLGTMPSIEAMRLFVKILEEDD 101

  Fly    79 P 79
            |
plant   102 P 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:469667 18/61 (30%)
ACBP4NP_974227.1 ACBP 14..97 CDD:459982 18/59 (31%)
NanM 182..426 CDD:442289
KELCH repeat 185..241 CDD:276965
KELCH repeat 245..293 CDD:276965
KELCH repeat 296..337 CDD:276965
KELCH repeat 347..395 CDD:276965
NanM 392..>481 CDD:442289
KELCH repeat 398..440 CDD:276965
Crescentin 552..>647 CDD:437057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.