DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and Acbd7

DIOPT Version :9

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_084339.1 Gene:Acbd7 / 78245 MGIID:1925495 Length:88 Species:Mus musculus


Alignment Length:82 Identity:37/82 - (45%)
Similarity:48/82 - (58%) Gaps:6/82 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVD 64
            |||:...:..:....:|..|...|.||||||...|||||..||  |.:|.||::||..:||||.:
Mouse     5 ADFDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIACPAMLDLKGKAKWEAWNLQKGLSKE 69

  Fly    65 DAKAAYVA----LYEKY 77
            ||..||::    |.|||
Mouse    70 DAMCAYISKARELIEKY 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:412233 34/79 (43%)
Acbd7NP_084339.1 ACBP 3..87 CDD:381873 37/82 (45%)
Acyl-CoA binding. /evidence=ECO:0000250 30..34 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.