DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and acbd7

DIOPT Version :9

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001165067.1 Gene:acbd7 / 779685 XenbaseID:XB-GENE-5740466 Length:88 Species:Xenopus tropicalis


Alignment Length:82 Identity:37/82 - (45%)
Similarity:47/82 - (57%) Gaps:6/82 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVD 64
            |||:...|..|....:|..|...|.||||||...|||||:.|.  |.:..||:|||..:||||.:
 Frog     5 ADFDKAAEDVKKLKTRPTDEELKELYGLYKQSTVGDINIDCPGMLDLKAKAKWDAWNLKKGLSKE 69

  Fly    65 DAKAAYVA----LYEKY 77
            :|..||::    |.|||
 Frog    70 EAMHAYISKTNELVEKY 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:412233 34/79 (43%)
acbd7NP_001165067.1 ACBP 4..87 CDD:238248 37/82 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.