powered by:
Protein Alignment Acbp5 and Acbd4
DIOPT Version :9
Sequence 1: | NP_648255.1 |
Gene: | Acbp5 / 39005 |
FlyBaseID: | FBgn0035926 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_080264.1 |
Gene: | Acbd4 / 67131 |
MGIID: | 1914381 |
Length: | 329 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 24/73 - (32%) |
Similarity: | 35/73 - (47%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 ADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVD 64
|..:.|....|..|.:|..|..|.||..|||...|...:.:|. |..|..|:|||.....:|.:
Mouse 16 AAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNRLGKMSRE 80
Fly 65 DAKAAYVA 72
:|.:||::
Mouse 81 EAMSAYIS 88
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp5 | NP_648255.1 |
ACBP |
2..76 |
CDD:412233 |
24/73 (33%) |
Acbd4 | NP_080264.1 |
ACBP |
11..91 |
CDD:279259 |
24/73 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.