DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and Dbil5

DIOPT Version :9

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_067607.1 Gene:Dbil5 / 59116 RGDID:68360 Length:87 Species:Rattus norvegicus


Alignment Length:52 Identity:22/52 - (42%)
Similarity:30/52 - (57%) Gaps:2/52 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YGLYKQFQEGDINIEKP--ADAEGAAKYDAWLSRKGLSVDDAKAAYVALYEK 76
            |..|||..:||.||..|  .|.:..||::||:..||:|..||...|:|..|:
  Rat    29 YSFYKQATQGDCNIPVPPATDVKAKAKWEAWMVNKGMSKMDAMRIYIAKVEE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:412233 21/50 (42%)
Dbil5NP_067607.1 ACBP 2..85 CDD:238248 22/52 (42%)
Acyl-CoA binding. /evidence=ECO:0000250 29..33 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.