powered by:
Protein Alignment Acbp5 and Dbil5
DIOPT Version :9
Sequence 1: | NP_648255.1 |
Gene: | Acbp5 / 39005 |
FlyBaseID: | FBgn0035926 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_067607.1 |
Gene: | Dbil5 / 59116 |
RGDID: | 68360 |
Length: | 87 |
Species: | Rattus norvegicus |
Alignment Length: | 52 |
Identity: | 22/52 - (42%) |
Similarity: | 30/52 - (57%) |
Gaps: | 2/52 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 YGLYKQFQEGDINIEKP--ADAEGAAKYDAWLSRKGLSVDDAKAAYVALYEK 76
|..|||..:||.||..| .|.:..||::||:..||:|..||...|:|..|:
Rat 29 YSFYKQATQGDCNIPVPPATDVKAKAKWEAWMVNKGMSKMDAMRIYIAKVEE 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG63566 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1588000at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23310 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.930 |
|
Return to query results.
Submit another query.