DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and Acbp2

DIOPT Version :10

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster


Alignment Length:80 Identity:31/80 - (38%)
Similarity:46/80 - (57%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVDDA 66
            |||..||.|:.:|:|..:.:|:.|.|:||...||.:..||.  |.:|.||::||..:||.|.:.|
  Fly     6 FNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSEAA 70

  Fly    67 KAAYVALYE----KY 77
            :..|:...|    ||
  Fly    71 QQEYITFVEGLVAKY 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:469667 29/77 (38%)
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 31/80 (39%)

Return to query results.
Submit another query.