DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and Acbp6

DIOPT Version :9

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001286963.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster


Alignment Length:81 Identity:43/81 - (53%)
Similarity:53/81 - (65%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPADAEGAAKYDAWLSRKGLSVDD 65
            |..|..|:||.|.|...|..|.:|||||.|||...||.|||:|.|.|..|:|:||.|:.||:.||
  Fly     1 MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKARYNAWKSKAGLTADD 65

  Fly    66 AKAAYVALYEKYNPIY 81
            |||.|:.:|:||.|.|
  Fly    66 AKAYYIEVYKKYAPQY 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:412233 38/73 (52%)
Acbp6NP_001286963.1 ACBP 4..79 CDD:395715 40/74 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470130
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D148937at50557
OrthoFinder 1 1.000 - - FOG0019868
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10534
76.850

Return to query results.
Submit another query.