DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and Acbp1

DIOPT Version :9

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster


Alignment Length:73 Identity:32/73 - (43%)
Similarity:43/73 - (58%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSV 63
            :.:||...|..|..:..|.....||.|.||||...||.|.:||.  |.:|.||::||.:|||:|.
  Fly     4 LQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSN 68

  Fly    64 DDAKAAYV 71
            .||:|||:
  Fly    69 TDAQAAYI 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:412233 32/72 (44%)
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 32/72 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D148937at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.