powered by:
Protein Alignment Acbp5 and Acbd4
DIOPT Version :9
Sequence 1: | NP_648255.1 |
Gene: | Acbp5 / 39005 |
FlyBaseID: | FBgn0035926 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_008766506.1 |
Gene: | Acbd4 / 303577 |
RGDID: | 1308404 |
Length: | 337 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 25/72 - (34%) |
Similarity: | 35/72 - (48%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 ADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVD 64
|..:.|....|..|.:|..|..|.||..|||...|...:.:|. |..|..|:|||.|...:|.:
Rat 16 AAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATAGPCLVPRPGFWDPIGRYKWDAWNSLGKMSRE 80
Fly 65 DAKAAYV 71
:|.:||:
Rat 81 EAMSAYI 87
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp5 | NP_648255.1 |
ACBP |
2..76 |
CDD:412233 |
25/72 (35%) |
Acbd4 | XP_008766506.1 |
ACBP |
11..91 |
CDD:279259 |
25/72 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.