DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and Acbd6

DIOPT Version :10

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001011906.1 Gene:Acbd6 / 289125 RGDID:1305030 Length:282 Species:Rattus norvegicus


Alignment Length:61 Identity:23/61 - (37%)
Similarity:31/61 - (50%) Gaps:2/61 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EVYLEFYGLYKQFQEGDINIEKP--ADAEGAAKYDAWLSRKGLSVDDAKAAYVALYEKYNP 79
            |..|..|..|||.:.|:.||.||  .|.||..|::||.:....|...|...|:|..:|.:|
  Rat    63 EQLLYLYARYKQVKVGNCNIPKPNFFDFEGKQKWEAWKALGDSSPSQAMQEYIAAVKKLDP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:469667 21/56 (38%)
Acbd6NP_001011906.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
ACBP 43..118 CDD:459982 21/54 (39%)
ANKYR <166..>261 CDD:440430
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.