DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acbp5 and Eci2

DIOPT Version :9

Sequence 1:	NP_648255.1	Gene:	Acbp5 / 39005	FlyBaseID:	FBgn0035926	Length:	82	Species:	Drosophila melanogaster
Sequence 2:	NP_001103801.1	Gene:	Eci2 / 23986	MGIID:	1346064	Length:	391	Species:	Mus musculus

Alignment Length:	73	Identity:	30/73 - (41%)
Similarity:	36/73 - (49%)	Gaps:	2/73 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 DFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVDD 65
            ||...|.:.|...|.|..||.|..|.||||..||..|:.||.  |....||:|||.:...|..:.
Mouse    40 DFENALNQVKLLKKDPGNEVKLRLYALYKQATEGPCNMPKPGMLDFVNKAKWDAWNALGSLPKET 104

  Fly    66 AKAAYVAL 73
            |:..||.|
Mouse   105 ARQNYVDL 112

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acbp5	NP_648255.1	ACBP	2..76	CDD:412233	30/73 (41%)
Eci2	NP_001103801.1	ACBP	38..113	CDD:279259	30/73 (41%)
		Acyl-CoA binding. /evidence=ECO:0000250	64..68		2/3 (67%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	116..136
		crotonase-like	139..389	CDD:304874
		ECH-like	149..319
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:Q05871	196..200
		Microbody targeting signal. /evidence=ECO:0000255	389..391
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4281
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810