DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and acbp-4

DIOPT Version :10

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_498609.1 Gene:acbp-4 / 186372 WormBaseID:WBGene00018949 Length:146 Species:Caenorhabditis elegans


Alignment Length:74 Identity:22/74 - (29%)
Similarity:31/74 - (41%) Gaps:6/74 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FNAILEKTKAFSKKPPTEV----YLEFYGLYKQFQEGDINIEKP--ADAEGAAKYDAWLSRKGLS 62
            |.|.:....|..|..|.:.    .|:.|.||||...|..:..:|  ...|...|::||.....:.
 Worm     9 FEAAVWIINALPKNGPIKTSINDQLQMYSLYKQATSGKCDTIQPYFFQIEQRMKWNAWNQLGNMD 73

  Fly    63 VDDAKAAYV 71
            ..:|||.||
 Worm    74 EAEAKAQYV 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:469667 22/74 (30%)
acbp-4NP_498609.1 ACBP 5..93 CDD:238248 22/74 (30%)

Return to query results.
Submit another query.