DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and acbp-3

DIOPT Version :9

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_509822.2 Gene:acbp-3 / 181281 WormBaseID:WBGene00009818 Length:116 Species:Caenorhabditis elegans


Alignment Length:84 Identity:27/84 - (32%)
Similarity:44/84 - (52%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FNAILEKTKAFSKKPP----TEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLS 62
            |:|.:|..:...|..|    .:..|.||.|:||...||:|.::|.  ......|:|:|...:|:|
 Worm     7 FDAAVEIIQKLPKTGPVATSNDQKLTFYSLFKQASIGDVNTDRPGIFSIIERKKWDSWKELEGVS 71

  Fly    63 VDDAKAAYV-ALYEKYNPI 80
            .|:||..|: ||.:.::.|
 Worm    72 QDEAKERYIKALNDMFDKI 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:412233 26/78 (33%)
acbp-3NP_509822.2 ACBP 3..91 CDD:238248 27/84 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10534
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.