powered by:
Protein Alignment Acbp5 and maa-1
DIOPT Version :9
Sequence 1: | NP_648255.1 |
Gene: | Acbp5 / 39005 |
FlyBaseID: | FBgn0035926 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499531.1 |
Gene: | maa-1 / 176612 |
WormBaseID: | WBGene00007680 |
Length: | 266 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 22/57 - (38%) |
Similarity: | 34/57 - (59%) |
Gaps: | 2/57 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 KPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVDDAKAAYV 71
|..|:..|.||.|:||...|..::.||: |.:|..|::||.....:::|:||.|||
Worm 21 KTSTDEKLNFYALFKQATHGKCDLPKPSFYDIQGVYKWNAWNKLDNMTMDEAKQAYV 77
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp5 | NP_648255.1 |
ACBP |
2..76 |
CDD:412233 |
22/57 (39%) |
maa-1 | NP_499531.1 |
ACBP |
3..84 |
CDD:376410 |
22/57 (39%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.