DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and DBI

DIOPT Version :10

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001171488.1 Gene:DBI / 1622 HGNCID:2690 Length:148 Species:Homo sapiens


Alignment Length:83 Identity:35/83 - (42%)
Similarity:43/83 - (51%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVD 64
            |:|....|:.:....||..|..|..||.|||...||||.|:|.  |..|.||:|||...||.|.:
Human    65 AEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKE 129

  Fly    65 DAKAAYVALYEKYNPIYG 82
            ||..||:...|:....||
Human   130 DAMKAYINKVEELKKKYG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:469667 32/75 (43%)
DBINP_001171488.1 ACBP 74..147 CDD:238248 30/72 (42%)

Return to query results.
Submit another query.