DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp5 and ECI2

DIOPT Version :9

Sequence 1:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_996667.2 Gene:ECI2 / 10455 HGNCID:14601 Length:394 Species:Homo sapiens


Alignment Length:79 Identity:30/79 - (37%)
Similarity:39/79 - (49%) Gaps:2/79 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVDD 65
            ||...:.:.|...|.|..||.|:.|.||||..||..|:.||.  |....||:|||.:...|..:.
Human    42 DFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEA 106

  Fly    66 AKAAYVALYEKYNP 79
            |:..||.|....:|
Human   107 ARQNYVDLVSSLSP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp5NP_648255.1 ACBP 2..76 CDD:412233 29/74 (39%)
ECI2NP_996667.2 ACBP 40..113 CDD:279259 27/70 (39%)
Acyl-CoA binding. /evidence=ECO:0000250 66..70 2/3 (67%)
crotonase-like 142..335 CDD:119339
ECH-like 151..322
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 198..202
Microbody targeting signal. /evidence=ECO:0000255 392..394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.