powered by:
Protein Alignment Acbp5 and acbd5b
DIOPT Version :9
Sequence 1: | NP_648255.1 |
Gene: | Acbp5 / 39005 |
FlyBaseID: | FBgn0035926 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005171195.1 |
Gene: | acbd5b / 100004736 |
ZFINID: | ZDB-GENE-070705-18 |
Length: | 425 |
Species: | Danio rerio |
Alignment Length: | 48 |
Identity: | 21/48 - (43%) |
Similarity: | 24/48 - (50%) |
Gaps: | 2/48 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 FYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVDDAKAAYV 71
||..|||..||..|..||. |..|.||::||.....:|.|.|...||
Zfish 42 FYSYYKQATEGPCNTLKPNSWDPIGKAKWEAWKDLGNMSKDQAMTEYV 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp5 | NP_648255.1 |
ACBP |
2..76 |
CDD:412233 |
21/48 (44%) |
acbd5b | XP_005171195.1 |
ACBP |
13..97 |
CDD:279259 |
21/48 (44%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.