Sequence 1: | NP_001241667.1 | Gene: | RND3 / 390 | HGNCID: | 671 | Length: | 244 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261247.1 | Gene: | Rac1 / 38146 | FlyBaseID: | FBgn0010333 | Length: | 192 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 84/195 - (43%) |
---|---|---|---|
Similarity: | 124/195 - (63%) | Gaps: | 11/195 - (5%) |
- Green bases have known domain annotations that are detailed below.
Human 20 QNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYY 84
Human 85 DNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVEL 149
Human 150 SNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFH--VATLACVNKTNKNVKRNKSQR 212
Human 213 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RND3 | NP_001241667.1 | Rnd3_RhoE_Rho8 | 19..200 | CDD:206735 | 80/181 (44%) |
Effector region. /evidence=ECO:0000255 | 52..60 | 5/7 (71%) | |||
Rac1 | NP_001261247.1 | Rac1_like | 3..176 | CDD:206663 | 78/175 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |