DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RND3 and Rac1

DIOPT Version :9

Sequence 1:NP_001241667.1 Gene:RND3 / 390 HGNCID:671 Length:244 Species:Homo sapiens
Sequence 2:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster


Alignment Length:195 Identity:84/195 - (43%)
Similarity:124/195 - (63%) Gaps:11/195 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    20 QNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYY 84
            |.:||  |||||...|||.||..:..:.||..|:||||:||:|:..:|.:.|.|.||||:|...|
  Fly     2 QAIKC--VVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDY 64

Human    85 DNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVEL 149
            |.:||||||.:|..||||.:..|.:.::|..||..|::..||:|.::|||.|.|||.|.:|:.:|
  Fly    65 DRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKL 129

Human   150 SNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFH--VATLACVNKTNKNVKRNKSQR 212
            .:.:..|::|.||..|||:|||..|:||||| ::..::.:|.  :.::.|      .|.:.||:|
  Fly   130 RDKKLAPITYPQGLAMAKEIGAVKYLECSAL-TQKGLKTVFDEAIRSVLC------PVLQPKSKR 187

Human   213  212
              Fly   188  187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RND3NP_001241667.1 Rnd3_RhoE_Rho8 19..200 CDD:206735 80/181 (44%)
Effector region. /evidence=ECO:0000255 52..60 5/7 (71%)
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 78/175 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.