DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and HES7

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_016880721.1 Gene:HES7 / 84667 HGNCID:15977 Length:265 Species:Homo sapiens


Alignment Length:365 Identity:78/365 - (21%)
Similarity:114/365 - (31%) Gaps:129/365 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTGVTAANMTNVLGTAVVPAQLKETPLKS---------DRRSN-------KPIMEKRRRARINN 49
            |..|..:..:...||...:..|....|:.:         ||..|       ||::|||||.|||.
Human     1 MSKGAGSGPIPPTLGPRNIRLQASREPVHTGSGGAMVTRDRAENRDGPKMLKPLVEKRRRDRINR 65

  Fly    50 CLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAADP-----------KI 103
            .|.||:.|:|:.|:....|:.|||||:|||..|.:|:|  |.:.....||.|           .:
Human    66 SLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRE--RSRVEPPAAAAPGVPRSPVQDAEAL 128

  Fly   104 VNKFKAGFADCVNEVSRFP-GIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQSIHAQMLPSP 167
            .:.:.:||.:|:..::.|. ...||.|.:|.                       .::|..:.|.|
Human   129 ASCYLSGFRECLLRLAAFAHDASPAARAQLF-----------------------SALHGYLRPKP 170

  Fly   168 PSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQ 232
            |.....|.:..|..|                                                  
Human   171 PRPKPVDPRPPAPRP-------------------------------------------------- 185

  Fly   233 QQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANS 297
                .|..||.|...|..|:.|:....|....:...:.....||...||...:.....||.|...
Human   186 ----SLDPAAPALGPALHQRPPVHQGHPSPRCAWSPSLCSPRAGDSGAPAPLTGLLPPPPPPHRQ 246

  Fly   298 SYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW 337
            ...|         :.|:...|..             ||||
Human   247 DGAP---------KAPLPPPPAF-------------WRPW 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 30/74 (41%)
ORANGE 106..141 CDD:128787 8/35 (23%)
HES7XP_016880721.1 HLH 49..108 CDD:238036 29/60 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.