DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and Hes7

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_149030.2 Gene:Hes7 / 84653 MGIID:2135679 Length:225 Species:Mus musculus


Alignment Length:308 Identity:68/308 - (22%)
Similarity:100/308 - (32%) Gaps:106/308 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQ-----AAM 95
            ||::|||||.|||..|.||:.|:|:.|:....|:.|||||:|||..|.:|:|..|.:     .:.
Mouse    17 KPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPGVPRSP 81

  Fly    96 QQAADPKIVNKFKAGFADCVNEVSRFP-GIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQSI 159
            .|.|: .:.:.:.:||.:|:..::.|. ...||.|.:|.                       .::
Mouse    82 GQDAE-ALASCYLSGFRECLLRLAAFAHDASPAARSQLF-----------------------SAL 122

  Fly   160 HAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQ 224
            |....|.||.....|  .|..||                                          
Mouse   123 HGYRRPKPPRPEAVD--PGLPAP------------------------------------------ 143

  Fly   225 QQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSY 289
                      :..|..|:.....|..|:.|:....|....:...:...|.||...||...:....
Mouse   144 ----------RPPLDPASPILGPALHQRPPVHQGPPSPRLAWSPSHCSSRAGDSGAPAPLTGLLP 198

  Fly   290 APPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW 337
            .||.|......|         :.|....|..             ||||
Mouse   199 PPPPPYRQDGAP---------KAPSLPPPAF-------------WRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 27/51 (53%)
ORANGE 106..141 CDD:128787 8/35 (23%)
Hes7NP_149030.2 HLH 14..73 CDD:238036 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..225 28/177 (16%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.