DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and Bhlhe40

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_445780.2 Gene:Bhlhe40 / 79431 RGDID:68439 Length:411 Species:Rattus norvegicus


Alignment Length:196 Identity:60/196 - (30%)
Similarity:84/196 - (42%) Gaps:57/196 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQEL-----QRQQAAMQ- 96
            ::||:||.|||.|:.:||.|:.:..|.....|  ||||.:||.|:||::.|     |:||..|. 
  Rat    59 LIEKKRRDRINECIAQLKDLLPEHLKLTTLGH--LEKAVVLELTLKHVKALTNLIDQQQQKIMAL 121

  Fly    97 ----QAADPKIVN------KFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCIN-------GVK 144
                ||.|....|      .|.:||..|..||              ||:|:...|       .:.
  Rat   122 QSGLQAGDLSGRNIEAGQEMFCSGFQTCAREV--------------LQYLAKHENTRDLKSSQLV 172

  Fly   145 TELHQQQRQQQQQSIHAQML---PSPPSSPEQDS--QQGAAAPYLFG------IQQTASGYFLPN 198
            |.||:...:..|.|...:.|   |.|....|:.|  .:|:..|   |      ||:|    |.|:
  Rat   173 THLHRVVSELLQGSASRKPLDSAPKPVDFKEKPSFLAKGSEGP---GKNCVPVIQRT----FAPS 230

  Fly   199 G 199
            |
  Rat   231 G 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 22/49 (45%)
ORANGE 106..141 CDD:128787 9/34 (26%)
Bhlhe40NP_445780.2 Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer. /evidence=ECO:0000250 1..139 31/81 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
bHLH-O_DEC1 40..129 CDD:381592 29/71 (41%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 75..79 2/3 (67%)
ORANGE 140..184 CDD:128787 13/57 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..293 15/53 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.