DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and BHLHE41

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_110389.1 Gene:BHLHE41 / 79365 HGNCID:16617 Length:482 Species:Homo sapiens


Alignment Length:320 Identity:75/320 - (23%)
Similarity:115/320 - (35%) Gaps:92/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQ- 86
            :|....|...:....::||:||.|||.|:.:||.|:.:..|.....|  ||||.:||.|:|||: 
Human    36 MKRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGH--LEKAVVLELTLKHLKA 98

  Fly    87 -----ELQRQQAAMQQAADPKI-------VNKFKAGFADCVNEV----SRFPGIEPAQRR--RLL 133
                 |.|.|:....|..:..:       ::.|.:||..|..||    |||....|.:.|  :|:
Human    99 LTALTEQQHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLI 163

  Fly   134 QHLSNCINGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQ-DSQQGAAAPYLFGIQQTASGYFLP 197
            .||                    .::..|.||:|....:| ...:|..||...|  ..|:.....
Human   164 NHL--------------------HAVATQFLPTPQLLTQQVPLSKGTGAPSAAG--SAAAPCLER 206

  Fly   198 NGMQVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAV---------------------- 240
            .|.::.|       :|..:|          ::|..|...:||.                      
Human   207 AGQKLEP-------LAYCVP----------VIQRTQPSAELAAENDTDTDSGYGGEAEARPDREK 254

  Fly   241 --AAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAP---PSPA 295
              .|.|:.....|:.|...|...:.....|....|..|    ||..::.:.|.   |.||
Human   255 GKGAGASRVTIKQEPPGEDSPAPKRMKLDSRGGGSGGG----PGGGAAAAAAALLGPDPA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 24/64 (38%)
ORANGE 106..141 CDD:128787 14/40 (35%)
BHLHE41NP_110389.1 bHLH-O_DEC2 31..122 CDD:381593 29/87 (33%)
Necessary for interaction with RXRA and repressor activity towards RXRA. /evidence=ECO:0000269|PubMed:19786558 67..71 2/3 (67%)
ORANGE 129..175 CDD:128787 15/65 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..298 12/73 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 438..482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.