DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and Hes5

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_038966759.1 Gene:Hes5 / 79225 RGDID:621340 Length:196 Species:Rattus norvegicus


Alignment Length:201 Identity:51/201 - (25%)
Similarity:87/201 - (43%) Gaps:51/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARH---SKLEKADILEKTVKHLQELQR 90
            |...|..||::||.||.|||:.:.:||.|:    :::.|||   ||||||||||..|.:|:..:.
  Rat    14 KEKNRLRKPVVEKMRRDRINSSIEQLKLLL----EQEFARHQPNSKLEKADILEMAVSYLKHSKG 74

  Fly    91 Q--------------------------QAAMQQAADPKIVNK-FKAGFADCVNEVSRFPGIEPAQ 128
            :                          ..|...||.||.::: :..|::.|:.|..:|..:..|.
  Rat    75 ELGACARVLLPTGVAPTARAPLMPLGLPTAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAAS 139

  Fly   129 --RRRLLQHLSNCINGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTA 191
              :.:||.|.               ::....:...:..|:|.::|:.......||..:...:|:|
  Rat   140 DTQMKLLYHF---------------QRPPAPAAPVKETPTPGAAPQPARSSTKAAASVSTSRQSA 189

  Fly   192 SGYFLP 197
            .|.:.|
  Rat   190 CGLWRP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 29/61 (48%)
ORANGE 106..141 CDD:128787 8/37 (22%)
Hes5XP_038966759.1 bHLH-O_HES5 18..74 CDD:381467 28/59 (47%)
ORANGE 116..158 CDD:128787 8/56 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.