DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and hes2.2

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001038818.1 Gene:hes2.2 / 751634 ZFINID:ZDB-GENE-060825-55 Length:172 Species:Danio rerio


Alignment Length:157 Identity:55/157 - (35%)
Similarity:83/157 - (52%) Gaps:25/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQ 96
            |::.||::||:||||||:.|:.||.|||..|.||..|:||||||||||.||:.|.::|     ..
Zfish     9 RKTLKPLLEKKRRARINDSLDRLKALILPLTGKDNCRYSKLEKADILEMTVRFLTDIQ-----TT 68

  Fly    97 QAADPKIVNKFKAGFADCVNEVS-RFP--GIEPAQRRRLLQHL-----------SNCINGVKTEL 147
            .:.|..:  .|..|:..|:..|| |.|  .::...|.|:...:           .||.  .::..
Zfish    69 PSKDTAV--SFTEGYTTCLQRVSARLPQTSLDAETRHRVNDFIQRSVMPKTPACQNCC--AQSSR 129

  Fly   148 HQQQRQQQQQSIHAQMLPSPPSSPEQD 174
            ...|.||:.|::.:.  .|..::|:||
Zfish   130 MMSQIQQKLQNLKSS--SSRSTNPKQD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 34/55 (62%)
ORANGE 106..141 CDD:128787 11/48 (23%)
hes2.2NP_001038818.1 HLH 6..67 CDD:238036 35/62 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.