DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and hes5.1

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001037880.1 Gene:hes5.1 / 733463 XenbaseID:XB-GENE-481135 Length:154 Species:Xenopus tropicalis


Alignment Length:157 Identity:52/157 - (33%)
Similarity:75/157 - (47%) Gaps:30/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KSDRRSNKPIMEKRRRARINNCLNELKTLI-LDATKKDPARHSKLEKADILEKTVKHLQELQRQQ 92
            |...:..|||:||.||.||||.:.:||.|: .:..|::|  :.|||||||||..|.:||:.:.|.
 Frog    14 KEKNKLRKPIVEKMRRDRINNSIEQLKALLEKEFHKQEP--NVKLEKADILEMAVSYLQQQKSQS 76

  Fly    93 AAMQQAADPKIVNKFKAGFADCVNEVSRFPGIEPAQ---RRRLLQHLSNCINGVKTELHQQQRQQ 154
            ..:     .|:...:|.||:.|:.|..:|....|..   :.:||:||                 |
 Frog    77 PNL-----AKLEQDYKQGFSSCLREAVQFLCYYPESGETQMKLLKHL-----------------Q 119

  Fly   155 QQQSIHAQMLPSPPSSPEQDSQQGAAA 181
            ..|.:....|...||  ..||:|.|.|
 Frog   120 APQKLSVAPLTYIPS--VSDSKQAALA 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 29/59 (49%)
ORANGE 106..141 CDD:128787 11/37 (30%)
hes5.1NP_001037880.1 HLH 14..75 CDD:238036 29/62 (47%)
Hairy_orange 84..121 CDD:295407 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.