DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and her7

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_021331987.1 Gene:her7 / 58132 ZFINID:ZDB-GENE-000427-6 Length:221 Species:Danio rerio


Alignment Length:146 Identity:43/146 - (29%)
Similarity:77/146 - (52%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAAD 100
            ||.:|:|||.|:|..|..||.|:|...:.:.....:||||:|||.||..||:..:  |:.::..:
Zfish    33 KPQVERRRRERMNRSLENLKLLLLQGPEHNQPNQRRLEKAEILEYTVLFLQKANK--ASKEEEGE 95

  Fly   101 PKIVNKFKAGFADCVNEVSRF----PGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQSIHA 161
            .|  ::|..||:.|:.:.:||    .|:|.:....|.|.|::  ..::..:....|:|     ||
Zfish    96 EK--SQFMEGFSSCLQKAARFLLEEGGLEGSVTSMLCQRLAH--PTIRLPVRGHSRKQ-----HA 151

  Fly   162 QMLPSPPSSPEQDSQQ 177
            :      |:|:..:::
Zfish   152 E------SNPQHHARR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 24/51 (47%)
ORANGE 106..141 CDD:128787 11/38 (29%)
her7XP_021331987.1 Hairy_orange 100..135 CDD:311465 11/34 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.