DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and HES4

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001135939.1 Gene:HES4 / 57801 HGNCID:24149 Length:247 Species:Homo sapiens


Alignment Length:211 Identity:82/211 - (38%)
Similarity:112/211 - (53%) Gaps:47/211 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GTAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILE 79
            ||..||          |.:|:||:||||||||||..|.:||||||||.:|:.:||||||||||||
Human    54 GTQPVP----------DPQSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILE 108

  Fly    80 KTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRF----PGIEPAQRRRLLQHLSNCI 140
            .||:||:.|:|.|.....:|||.::.|::|||.:|:.||:||    .|:....|.|||.||:.|:
Human   109 MTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACL 173

  Fly   141 NGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPT 205
                       ||.......|.:.|:.|:.        |.||.::.            |..::|:
Human   174 -----------RQLGPSRRPASLSPAAPAE--------APAPEVYA------------GRPLLPS 207

  Fly   206 KLPNGSIALVLPQSLP 221
            .  .|...|:.|..||
Human   208 L--GGPFPLLAPPLLP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 40/58 (69%)
ORANGE 106..141 CDD:128787 17/38 (45%)
HES4NP_001135939.1 HLH 62..119 CDD:238036 40/56 (71%)
Hairy_orange 136..174 CDD:284859 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7601
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4315
Isobase 1 0.950 - 0 Normalized mean entropy S4933
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105205
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17396
SonicParanoid 1 1.000 - - X3450
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.850

Return to query results.
Submit another query.