DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and her8.2

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001159638.1 Gene:her8.2 / 565269 ZFINID:ZDB-GENE-060815-4 Length:211 Species:Danio rerio


Alignment Length:235 Identity:66/235 - (28%)
Similarity:96/235 - (40%) Gaps:73/235 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQA 93
            |.:|:..||::|::||.|||.||::|:..::...|.|   .||||||||||.||||||.:|    
Zfish    20 KEERKLRKPLIERKRRERINLCLDQLRETVVAVFKPD---QSKLEKADILEMTVKHLQNIQ---- 77

  Fly    94 AMQQAADPKIVN-----KFKAGFADCVNEVSRF----PGIEPAQRRRLLQHL--------SNCIN 141
             ..:.:|| ::|     ::..|:..|:.||...    ..::.....|||.||        .:|..
Zfish    78 -SSRVSDP-VLNTGARQRYSTGYIQCMQEVHNLLHSCDWMDKTLGSRLLNHLFKSLPLSAKDCPR 140

  Fly   142 GVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIP-- 204
            ..||.|                    .|.|...|:..:     |.:.:|||    |......|  
Zfish   141 LPKTSL--------------------TSVPSDHSEYSS-----FHVDETAS----PKPCSSSPFL 176

  Fly   205 TKLPNGSIALVLPQSLPQQQQQQL----LQHQQQQQQLAV 240
            .|.||            |.|.|..    :.|..:...|:|
Zfish   177 CKRPN------------QSQNQHFTPIRMPHDVESSHLSV 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 31/58 (53%)
ORANGE 106..141 CDD:128787 10/46 (22%)
her8.2NP_001159638.1 HLH 20..77 CDD:238036 31/59 (53%)
Hairy_orange 94..132 CDD:284859 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.