DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and Hes6

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_062352.1 Gene:Hes6 / 55927 MGIID:1859852 Length:224 Species:Mus musculus


Alignment Length:325 Identity:77/325 - (23%)
Similarity:111/325 - (34%) Gaps:139/325 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQA 93
            :.||::.||::||:||||||..|.||: |:|..|:.    .:|||.|::||.||:.:|...|.:|
Mouse    23 RGDRKARKPLVEKKRRARINESLQELR-LLLAGTEV----QAKLENAEVLELTVRRVQGALRGRA 82

  Fly    94 AMQQAADPKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQS 158
            ..::....:...:|.||:..|::||..|              :|.|                 |:
Mouse    83 REREQLQAEASERFAAGYIQCMHEVHTF--------------VSTC-----------------QA 116

  Fly   159 IHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQ 223
            |.|                            |.|.                              
Mouse   117 IDA----------------------------TVSA------------------------------ 123

  Fly   224 QQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTAST-GSASSHSSAGYESAPGSSSSC 287
               :||.|                       :|.|||.|..|: ......|.||   .||.|...
Mouse   124 ---ELLNH-----------------------LLESMPLREGSSFQDLLGDSLAG---LPGGSGRS 159

  Fly   288 SY----APPSPANSSYEPMD--------IKPSVIQRVPMEQQPL---SLVIKKQIKEEEQPWRPW 337
            |:    :|.||.:|...|.|        |..:.:.|||.|...|   ||......:..:..||||
Mouse   160 SWPPGGSPESPLSSPPGPGDDLCSDLEEIPEAELNRVPAEGPDLVSTSLGSLTAARRAQSVWRPW 224

  Fly   338  337
            Mouse   225  224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 27/58 (47%)
ORANGE 106..141 CDD:128787 9/34 (26%)
Hes6NP_062352.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 2/7 (29%)
bHLH_SF 24..81 CDD:412148 28/61 (46%)
Hairy_orange 96..134 CDD:400076 19/152 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..209 20/65 (31%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.