DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and hes2.1

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_021333940.1 Gene:hes2.1 / 559147 ZFINID:ZDB-GENE-081104-104 Length:195 Species:Danio rerio


Alignment Length:325 Identity:78/325 - (24%)
Similarity:111/325 - (34%) Gaps:146/325 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GTAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILE 79
            |:.:..||.||.  ...|::.||:||||||||||:.||.||||||....||.:|:||||||||||
Zfish    15 GSRMTVAQRKEA--HELRKTLKPLMEKRRRARINDSLNHLKTLILPLVGKDASRYSKLEKADILE 77

  Fly    80 KTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCI--NG 142
            .||:.|::|....|..|       .:.:|.|:..|                  ||.:|..:  :.
Zfish    78 MTVRFLRDLPSSSAKGQ-------TDSYKEGYKAC------------------LQRISTMLPQSN 117

  Fly   143 VKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKL 207
            ::||.||:..:                                         |:           
Zfish   118 LETEAHQRVSE-----------------------------------------FI----------- 130

  Fly   208 PNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSH 272
                                       ||.:|.::::.....||...|:..|.||..|..:    
Zfish   131 ---------------------------QQSMASSSSSCQNCCAQNSKMISQMHQRLVSLRN---- 164

  Fly   273 SSAGYESAPGSSSSCSYAPPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW 337
                                  .||...|:...|:     |.:.||..       :..|..||||
Zfish   165 ----------------------NNSMENPISTVPA-----PSQPQPAP-------QAAEDMWRPW 195

  Fly   338  337
            Zfish   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 37/58 (64%)
ORANGE 106..141 CDD:128787 6/36 (17%)
hes2.1XP_021333940.1 HLH 30..86 CDD:306515 37/55 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.