DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and HES6

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_061115.2 Gene:HES6 / 55502 HGNCID:18254 Length:224 Species:Homo sapiens


Alignment Length:158 Identity:48/158 - (30%)
Similarity:76/158 - (48%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQA 93
            :.||::.||::||:||||||..|.||:.|:..|..:     :|||.|::||.||:.:|.:.|.:|
Human    23 RGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQ-----AKLENAEVLELTVRRVQGVLRGRA 82

  Fly    94 AMQQAADPKIVNKFKAGFADCVNEVSRF----PGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQ 154
            ..::....:...:|.||:..|::||..|    ..|:......||.||        .|....:...
Human    83 REREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHL--------LESMPLREGS 139

  Fly   155 QQQSIHAQMLPSPPSSPEQDSQQGAAAP 182
            ..|.:....|..||.:|.:.......||
Human   140 SFQDLLGDALAGPPRAPGRSGWPAGGAP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 26/58 (45%)
ORANGE 106..141 CDD:128787 12/38 (32%)
HES6NP_061115.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 2/7 (29%)
HLH 23..75 CDD:238036 25/56 (45%)
Hairy_orange 96..134 CDD:311465 13/45 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..205 6/21 (29%)
WRPW motif 221..224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.