DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hry and HES2

DIOPT Version :10

Sequence 1:NP_523977.2 Gene:hry / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_061962.2 Gene:HES2 / 54626 HGNCID:16005 Length:173 Species:Homo sapiens


Alignment Length:160 Identity:61/160 - (38%)
Similarity:88/160 - (55%) Gaps:26/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQ 96
            |:|.||::|||||||||..|::||.|||....::.:..|||||||:||.||:.||||   .|:..
Human    14 RKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQEL---PASSW 75

  Fly    97 QAADPKIVNKFKAGFADCVNEVSR-FPG---IEPAQRRRLLQHL-----SNCINGVKTELHQQQR 152
            ..|.|...:.::.|::.||..::| .|.   :|||...|||:||     |..::|.:.       
Human    76 PTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRRAASATLDGGRA------- 133

  Fly   153 QQQQQSIHAQMLPSPPSSPEQDSQQGAAAP 182
              ...|..:...|:|.|:||.     |:||
Human   134 --GDSSGPSAPAPAPASAPEP-----ASAP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hryNP_523977.2 bHLH-O_hairy_like 30..88 CDD:381483 32/55 (58%)
ORANGE 106..141 CDD:128787 14/43 (33%)
HES2NP_061962.2 bHLH-O_HES2 10..74 CDD:381469 35/62 (56%)
ORANGE 84..127 CDD:128787 14/42 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..173 10/43 (23%)
WRPW motif 170..173
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.