DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and E(spl)m8-HLH

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster


Alignment Length:163 Identity:46/163 - (28%)
Similarity:83/163 - (50%) Gaps:17/163 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHL-QELQRQQAAM 95
            ::..||::|::||||:|.||:.||||:.:....|..  .:::||::||..|..: |:...::.|.
  Fly    11 QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQQKTPKKVAQ 73

  Fly    96 QQAADPKIVNKFKAGFADCVNEVSRF----PGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQ- 155
            ::.:.|  ::.||.|:.:.||||||.    ||:.....:.::.||......:: :.|:.|.... 
  Fly    74 EEQSLP--LDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQ-QFHEAQSAADF 135

  Fly   156 -QQSIHAQMLPSPPSSP-----EQDSQQGAAAP 182
             |.|:....:...|.||     ..|....|.:|
  Fly   136 IQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 21/56 (38%)
ORANGE 106..141 CDD:128787 13/38 (34%)
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 21/57 (37%)
ORANGE 81..125 CDD:128787 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438352
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.