DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:324 Identity:72/324 - (22%)
Similarity:123/324 - (37%) Gaps:129/324 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQ----- 91
            |:..||::|::||||||.||::||.|:::..:::....::||||||||.||.|:::|:::     
  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSL 76

  Fly    92 QAAMQQAADPKI------VNKFKAGFADCVNEVSRFPGIEPAQR----RRLLQHLSNCINGVKTE 146
            |..:.....|..      |..|::|:....:::::.. ::..|.    |::::.||..:..::|:
  Fly    77 QGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVL-LQTQQTDEIGRKIMKFLSTRLIELQTQ 140

  Fly   147 LHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGS 211
            |.|||:||||   |.|.                                          ::|..|
  Fly   141 LLQQQQQQQQ---HQQQ------------------------------------------QIPQSS 160

  Fly   212 IALVLPQSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQR---TASTGSASSHS 273
            ..|..|                   .|.....||||||......|.|..:.   |:..|:|.|.:
  Fly   161 GRLAFP-------------------LLGGYGPAAAAAAISYSSFLTSKDELIDVTSVDGNALSET 206

  Fly   274 SAGYESAPGSSSSCSYAPPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW 337
            ::......|:|               ||:                               ||||
  Fly   207 ASVSSQESGAS---------------EPV-------------------------------WRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 26/55 (47%)
ORANGE 106..141 CDD:128787 6/38 (16%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 27/57 (47%)
ORANGE 96..136 CDD:128787 6/40 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438343
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.