DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:176 Identity:56/176 - (31%)
Similarity:91/176 - (51%) Gaps:35/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQ---- 92
            |:..||::|::||||||.||:|||.::::...::....::||||||||.||:|:::|:.|:    
  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRL 78

  Fly    93 ----AAMQQAADPK--IVNKFKAGFADCVNEVSR----FPGIEPAQRRRLLQHLSNCIN------ 141
                ..:..:||||  |...|:||:....||||:    .||:......:|:.||.:.:|      
  Fly    79 SSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQVVV 143

  Fly   142 -----GVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAP 182
                 ||..          |..:..|.:.:||.|.....:.||.:|
  Fly   144 PSLPIGVPL----------QAPVEDQAMVTPPPSECDSLESGACSP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 26/55 (47%)
ORANGE 106..141 CDD:128787 12/38 (32%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 28/60 (47%)
ORANGE 97..141 CDD:128787 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438340
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.