DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and E(spl)mgamma-HLH

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster


Alignment Length:313 Identity:77/313 - (24%)
Similarity:117/313 - (37%) Gaps:130/313 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARH-SKLEKADILEKTVKHLQELQRQQAAM 95
            |:..||::|::||||||.||:|||.|:: ||.:....| ::||||||||.||.|||::::|:...
  Fly    16 RKVMKPMLERKRRARINKCLDELKDLMV-ATLESEGEHVTRLEKADILELTVTHLQKMKQQRQHK 79

  Fly    96 QQAADPKI--VNKFKAGFADCVNEVSR----FPGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQ 154
            :.:.|..:  ...|::|:...||||||    .||:..:...:|:.||.             ||..
  Fly    80 RASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLG-------------QRLN 131

  Fly   155 QQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQS 219
            |.|....::||                                                      
  Fly   132 QIQPAEKEVLP------------------------------------------------------ 142

  Fly   220 LPQQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSS 284
                                |.|           |:.|.:..|.|.:...|..||  |..:|.|:
  Fly   143 --------------------VTA-----------PLSVHIANRDAYSVPISPISS--YAGSPNSN 174

  Fly   285 SSCSYAPPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW 337
            :|      |.::|....:|:       ..||...         ::||..||||
  Fly   175 TS------STSHSLLTTIDV-------TKMEDDS---------EDEENVWRPW 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 32/56 (57%)
ORANGE 106..141 CDD:128787 13/38 (34%)
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 33/61 (54%)
ORANGE 91..135 CDD:128787 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438349
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.